Use este identificador para citar ou linkar para este item: http://www.repositorio.ufc.br/handle/riufc/19114
Título: First isolation and antinociceptive activity of a lipid transfer protein from noni ( Morinda citrifolia ) seeds
Autor(es): Campos, Dyély C. O.
Costa, Andrea S.
Lima, Amanda D. R.
Lobo, Marina D. P.
Monteiro-Moreira, Ana Cristina O.
Moreira, Renato A.
Leal, Luzia K. A. M.
Miron, Diogo
Vasconcelos, Ilka M.
Oliveira, Hermógenes D.
Silva, Fredy D. A.
Palavras-chave: Morinda
Rubiaceae
Data do documento: 2016
Editor: International Journal of Biological Macromolecules
Citação: CAMPOS, D. C. O. ; COSTA, A. S. ; LIMA, A. D. R. ; SILVA, F. D. A. ; LOBO, M. P. ; MONTEIRO-MOREIRA, A. C. O. ; MOREIRA, R. A. ; LEAL, L. K. A. M. ; MIRON, D. ; VASCONCELOS, I. M. ; OLIVEIRA, H. D. (2016)
Abstract: In this study a novel heat-stable lipid transfer protein, designated Mc LTP 1 , was purified from noni ( Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg Mc LTP 1 from 100 g of noni seeds). Mc LTP 1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of Mc LTP 1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. Mc LTP 1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 ◦ C. Pretreatment of mice with Mc LTP 1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of Mc LTP 1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein.
Descrição: CAMPOS, Dyély C. O. et al. First isolation and antinociceptive activity of a lipid transfer protein from Noni (Morinda citrifolia) seeds. International Journal of Biological Macromolecules, v. 86, p. 71-79, 2016.
URI: http://www.repositorio.ufc.br/handle/riufc/19114
ISSN: 0141-8130
Aparece nas coleções:DFIFA - Artigos publicados em revista científica

Arquivos associados a este item:
Arquivo Descrição TamanhoFormato 
2016_art_dcocampos.pdf1,63 MBAdobe PDFVisualizar/Abrir


Os itens no repositório estão protegidos por copyright, com todos os direitos reservados, salvo quando é indicado o contrário.